SCOP 1.73: Domain d2asja1: 2asj A:241-341

Lineage for d2asja1 (2asj A:241-341)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (2 species)

7. Species Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (41 PDB entries)

8. Domain d2asja1: 2asj A:241-341 [127254]
   Other proteins in same PDB: d2asja2, d2asjb2
   automatically matched to d1n48a1
   complexed with ca, ddg

Details for d2asja1

PDB Entry: 2asj, 2.35 Å

PDB Description: oxoG-modified Preinsertion Binary Complex

PDB Compounds: (A:) DNA polymerase IV

SCOP Domain Sequences for d2asja1:

Sequence; same for both SEQRES and ATOM records:

>d2asja1 d.240.1.1 (A:241-341) DinB homolog (DBH) {Archaeon Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfi

Timeline for d2asja1:

• d2asja1 is new in SCOP 1.73
  
• d2asja1 appears in SCOP 1.75
  
• d2asja1 appears in the current release, SCOPe 2.08