Lineage for d2asca_ (2asc A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030457Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 3030458Protein alpha toxin [57111] (4 species)
    Anti-mammal and anti-insect scorpion toxin
  7. 3030464Species Leiurus quinquestriatus [TaxId:6883] [186952] (1 PDB entry)
  8. 3030465Domain d2asca_: 2asc A: [127247]
    automated match to d1lqh__
    complexed with cl, dr0, dr8, edo, eoh, k, moh, no3

Details for d2asca_

PDB Entry: 2asc (more details), 1.1 Å

PDB Description: scorpion toxin lqh-alpha-it
PDB Compounds: (A:) neurotoxin alpha-IT

SCOPe Domain Sequences for d2asca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2asca_ g.3.7.1 (A:) alpha toxin {Leiurus quinquestriatus [TaxId: 6883]}
mvrdayiaknyncvyecfrdaycnelctkngassgycqwagkygnacwcyalpdnvpirv
pgkcr

SCOPe Domain Coordinates for d2asca_:

Click to download the PDB-style file with coordinates for d2asca_.
(The format of our PDB-style files is described here.)

Timeline for d2asca_: