Lineage for d2asba1 (2asb A:108-183)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1314543Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1314898Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1315303Protein S1 domain of NusA [69265] (2 species)
  7. 1315304Species Mycobacterium tuberculosis [TaxId:1773] [69267] (3 PDB entries)
  8. 1315305Domain d2asba1: 2asb A:108-183 [127244]
    Other proteins in same PDB: d2asba2, d2asba3
    automatically matched to d1k0ra1
    protein/RNA complex

Details for d2asba1

PDB Entry: 2asb (more details), 1.5 Å

PDB Description: Structure of a Mycobacterium tuberculosis NusA-RNA complex
PDB Compounds: (A:) Transcription elongation protein nusA

SCOPe Domain Sequences for d2asba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2asba1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]}
stregeivagviqrdsranarglvvvrigtetkasegvipaaeqvpgesyehgnrlrcyv
vgvtrgareplitlsr

SCOPe Domain Coordinates for d2asba1:

Click to download the PDB-style file with coordinates for d2asba1.
(The format of our PDB-style files is described here.)

Timeline for d2asba1: