Lineage for d2as8b_ (2as8 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533756Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2533757Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2533758Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2534056Protein Major mite fecal allergen der p 1 [142848] (1 species)
  7. 2534057Species House-dust mite (Dermatophagoides pteronyssinus) [TaxId:6956] [142849] (3 PDB entries)
    Uniprot P08176 19-320! Uniprot P08176 99-320
  8. 2534062Domain d2as8b_: 2as8 B: [127243]
    automated match to d2as8a1
    complexed with mg

Details for d2as8b_

PDB Entry: 2as8 (more details), 1.95 Å

PDB Description: crystal structure of mature and fully active der p 1 allergen
PDB Compounds: (B:) Major mite fecal allergen Der p 1

SCOPe Domain Sequences for d2as8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2as8b_ d.3.1.1 (B:) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]}
tnacsingnapaeidlrqmrtvtpirmqggcgscwafsgvaatesaylayrqqsldlaeq
elvdcasqhgchgdtiprgieyiqhngvvqesyyryvareqscrrpnaqrfgisnycqiy
ppnankirealaqthsaiaviigikdldafrhydgrtiiqrdngyqpnyhavnivgysna
qgvdywivrnswdtnwgdngygyfaanidlmmieeypyvvil

SCOPe Domain Coordinates for d2as8b_:

Click to download the PDB-style file with coordinates for d2as8b_.
(The format of our PDB-style files is described here.)

Timeline for d2as8b_: