SCOPe 2.08: Domain d2as8b_: 2as8 B:

Lineage for d2as8b_ (2as8 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Major mite fecal allergen der p 1 [142848] (1 species)

7. Species House-dust mite (Dermatophagoides pteronyssinus) [TaxId:6956] [142849] (3 PDB entries)
   Uniprot P08176 19-320! Uniprot P08176 99-320

8. Domain d2as8b_: 2as8 B: [127243]
   automated match to d2as8a1
   complexed with mg

Details for d2as8b_

PDB Entry: 2as8, 1.95 Å

PDB Description: crystal structure of mature and fully active der p 1 allergen

PDB Compounds: (B:) Major mite fecal allergen Der p 1

SCOPe Domain Sequences for d2as8b_:

Sequence; same for both SEQRES and ATOM records:

>d2as8b_ d.3.1.1 (B:) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]}
tnacsingnapaeidlrqmrtvtpirmqggcgscwafsgvaatesaylayrqqsldlaeq
elvdcasqhgchgdtiprgieyiqhngvvqesyyryvareqscrrpnaqrfgisnycqiy
ppnankirealaqthsaiaviigikdldafrhydgrtiiqrdngyqpnyhavnivgysna
qgvdywivrnswdtnwgdngygyfaanidlmmieeypyvvil

Timeline for d2as8b_:

• d2as8b_ first appeared in SCOP 1.73, called d2as8b1
  
• d2as8b_ appears in SCOPe 2.07