![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (16 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (25 proteins) |
![]() | Protein Major mite fecal allergen der p 1 [142848] (1 species) |
![]() | Species House-dust mite (Dermatophagoides pteronyssinus) [TaxId:6956] [142849] (2 PDB entries) |
![]() | Domain d2as8a1: 2as8 A:1-222 [127242] complexed with mg; mutant |
PDB Entry: 2as8 (more details), 1.95 Å
SCOP Domain Sequences for d2as8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2as8a1 d.3.1.1 (A:1-222) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} tnacsingnapaeidlrqmrtvtpirmqggcgscwafsgvaatesaylayrqqsldlaeq elvdcasqhgchgdtiprgieyiqhngvvqesyyryvareqscrrpnaqrfgisnycqiy ppnankirealaqthsaiaviigikdldafrhydgrtiiqrdngyqpnyhavnivgysna qgvdywivrnswdtnwgdngygyfaanidlmmieeypyvvil
Timeline for d2as8a1: