SCOP 1.73: Domain d2as5n2: 2as5 N:396-575

Lineage for d2as5n2 (2as5 N:396-575)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)

6. Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)

8. Domain d2as5n2: 2as5 N:396-575 [127240]
   Other proteins in same PDB: d2as5f1, d2as5g1, d2as5m1, d2as5n1
   automatically matched to d1p7hl2
   complexed with mg; mutant

Details for d2as5n2

PDB Entry: 2as5, 2.7 Å

PDB Description: structure of the dna binding domains of nfat and foxp2 bound specifically to dna.

PDB Compounds: (N:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOP Domain Sequences for d2as5n2:

Sequence; same for both SEQRES and ATOM records:

>d2as5n2 b.2.5.3 (N:396-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
plewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplg
lqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidc
agilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsah

Timeline for d2as5n2:

• d2as5n2 is new in SCOP 1.73
  
• d2as5n2 appears in SCOP 1.75
  
• d2as5n2 appears in the current release, SCOPe 2.08