Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (7 families) |
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins) automatically mapped to Pfam PF00554 |
Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries) |
Domain d2as5m2: 2as5 M:396-575 [127238] Other proteins in same PDB: d2as5f_, d2as5g_, d2as5m1, d2as5n1 automatically matched to d1p7hl2 protein/DNA complex; complexed with mg |
PDB Entry: 2as5 (more details), 2.7 Å
SCOPe Domain Sequences for d2as5m2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2as5m2 b.2.5.3 (M:396-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} plewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplg lqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidc agilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsah
Timeline for d2as5m2:
View in 3D Domains from other chains: (mouse over for more information) d2as5f_, d2as5g_, d2as5n1, d2as5n2 |