SCOPe 2.08: Domain d2as5m1: 2as5 M:576-678

Lineage for d2as5m1 (2as5 M:576-678)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries)

8. Domain d2as5m1: 2as5 M:576-678 [127237]
   Other proteins in same PDB: d2as5f_, d2as5g_, d2as5m2, d2as5n2
   automatically matched to d1owrm1
   protein/DNA complex; complexed with mg

Details for d2as5m1

PDB Entry: 2as5, 2.7 Å

PDB Description: structure of the dna binding domains of nfat and foxp2 bound specifically to dna.

PDB Compounds: (M:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d2as5m1:

Sequence; same for both SEQRES and ATOM records:

>d2as5m1 b.1.18.1 (M:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

Timeline for d2as5m1:

• d2as5m1 first appeared in SCOP 1.73
  
• d2as5m1 appears in SCOPe 2.07