![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins) subgroup of the larger IPT/TIG domain family |
![]() | Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries) |
![]() | Domain d2as5m1: 2as5 M:576-678 [127237] Other proteins in same PDB: d2as5f_, d2as5g_, d2as5m2, d2as5n2 automatically matched to d1owrm1 protein/DNA complex; complexed with mg |
PDB Entry: 2as5 (more details), 2.7 Å
SCOPe Domain Sequences for d2as5m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2as5m1 b.1.18.1 (M:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]} elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
Timeline for d2as5m1:
![]() Domains from other chains: (mouse over for more information) d2as5f_, d2as5g_, d2as5n1, d2as5n2 |