SCOPe 2.08: Domain d2as5g_: 2as5 G:

Lineage for d2as5g_ (2as5 G:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186924] (29 PDB entries)

8. Domain d2as5g_: 2as5 G: [127236]
   Other proteins in same PDB: d2as5m1, d2as5m2, d2as5n1, d2as5n2
   automated match to d1d5va_
   protein/DNA complex; complexed with mg

Details for d2as5g_

PDB Entry: 2as5, 2.7 Å

PDB Description: structure of the dna binding domains of nfat and foxp2 bound specifically to dna.

PDB Compounds: (G:) Forkhead box protein P2

SCOPe Domain Sequences for d2as5g_:

Sequence; same for both SEQRES and ATOM records:

>d2as5g_ a.4.5.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
fvrvenvkgavwtvdeveyqkrr

Timeline for d2as5g_:

• d2as5g_ first appeared in SCOP 1.73, called d2as5g1
  
• d2as5g_ appears in SCOPe 2.07