| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (68 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186924] (16 PDB entries) |
| Domain d2as5f_: 2as5 F: [127235] Other proteins in same PDB: d2as5m1, d2as5m2, d2as5n1, d2as5n2 automated match to d1d5va_ protein/DNA complex; complexed with mg |
PDB Entry: 2as5 (more details), 2.7 Å
SCOPe Domain Sequences for d2as5f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2as5f_ a.4.5.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkc
fvrvenvkgavwtvdeveyqkrr
Timeline for d2as5f_: