SCOP 1.75: Domain d2as5f1: 2as5 F:503-584

Lineage for d2as5f1 (2as5 F:503-584)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.14: Forkhead DNA-binding domain [46832] (6 proteins)

6. Protein Forkhead box protein P2, FOXP2 [140265] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140266] (2 PDB entries)
   Uniprot O15409 503-584

8. Domain d2as5f1: 2as5 F:503-584 [127235]
   Other proteins in same PDB: d2as5m1, d2as5m2, d2as5n1, d2as5n2
   automatically matched to 2A07 F:503-584
   complexed with mg; mutant

Details for d2as5f1

PDB Entry: 2as5, 2.7 Å

PDB Description: structure of the dna binding domains of nfat and foxp2 bound specifically to dna.

PDB Compounds: (F:) Forkhead box protein P2

SCOP Domain Sequences for d2as5f1:

Sequence; same for both SEQRES and ATOM records:

>d2as5f1 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]}
vrppftyatlirqaimessdrqltlneiyswftrtfayfrrnaatwknavrhnlslhkcf
vrvenvkgavwtvdeveyqkrr

Timeline for d2as5f1:

• d2as5f1 first appeared in SCOP 1.73
  
• d2as5f1 is called d2as5f_ in SCOPe 2.01
  
• d2as5f1 appears in the current release, SCOPe 2.08, called d2as5f_