Lineage for d2as0b2 (2as0 B:73-396)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704539Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 704540Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) (S)
  5. 705283Family c.66.1.51: hypothetical RNA methyltransferase [142635] (4 proteins)
    C-terminal part of Pfam PF03602; similar to (Uracil-5-)-methyltransferase (Pfam 05958)
  6. 705284Protein Hypothetical protein PH1915, middle and C-terminal domains [142642] (1 species)
  7. 705285Species Archaeon Pyrococcus horikoshii [TaxId:53953] [142643] (1 PDB entry)
  8. 705287Domain d2as0b2: 2as0 B:73-396 [127230]
    Other proteins in same PDB: d2as0a1, d2as0b1
    automatically matched to 2AS0 A:73-396

Details for d2as0b2

PDB Entry: 2as0 (more details), 1.8 Å

PDB Description: Crystal Structure of PH1915 (APC 5817): A Hypothetical RNA Methyltransferase
PDB Compounds: (B:) hypothetical protein PH1915

SCOP Domain Sequences for d2as0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2as0b2 c.66.1.51 (B:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
inkdlfkrrikkaneyrkkvlkytnvyrmvygeadylpglivdrfndiaslqissagmer
fkldvaeaimevepgietvfekntgrsrrreglpeiervllgkekyrtiiqegrakfivd
mrgqktgffldqrenrlalekwvqpgdrvldvftytggfaihaaiagadevigidkspra
ietakenaklngvedrmkfivgsafeemeklqkkgekfdivvldppafvqhekdlkaglr
ayfnvnfaglnlvkdggilvtcscsqhvdlqmfkdmiiaagakagkflkmlepyrtqapd
hpilmaskdteylkclflyvedmr

SCOP Domain Coordinates for d2as0b2:

Click to download the PDB-style file with coordinates for d2as0b2.
(The format of our PDB-style files is described here.)

Timeline for d2as0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2as0b1