Lineage for d2as0b1 (2as0 B:1-72)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2432833Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2432834Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2432997Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins)
    N-terminal part of Pfam PF03602, structurally similar to PUA domain family
  6. 2432998Protein Hypothetical protein PH1915, N-terminal domain [141721] (1 species)
  7. 2432999Species Pyrococcus horikoshii [TaxId:53953] [141722] (1 PDB entry)
    Uniprot O59578 1-72
  8. 2433001Domain d2as0b1: 2as0 B:1-72 [127229]
    Other proteins in same PDB: d2as0a2, d2as0b2
    automated match to d2as0a1

Details for d2as0b1

PDB Entry: 2as0 (more details), 1.8 Å

PDB Description: Crystal Structure of PH1915 (APC 5817): A Hypothetical RNA Methyltransferase
PDB Compounds: (B:) hypothetical protein PH1915

SCOPe Domain Sequences for d2as0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2as0b1 b.122.1.9 (B:1-72) Hypothetical protein PH1915, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
marvvvdaqaaraigkgamivfkkgvvrvegdikpgdivevytrggkflgkgfanpnsni
mvrivtkdkdve

SCOPe Domain Coordinates for d2as0b1:

Click to download the PDB-style file with coordinates for d2as0b1.
(The format of our PDB-style files is described here.)

Timeline for d2as0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2as0b2