SCOPe 2.08: Domain d2as0b1: 2as0 B:1-72

Lineage for d2as0b1 (2as0 B:1-72)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (15 families)

5. Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins)
   N-terminal part of Pfam PF03602, structurally similar to PUA domain family

6. Protein Hypothetical protein PH1915, N-terminal domain [141721] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [141722] (1 PDB entry)
   Uniprot O59578 1-72

8. Domain d2as0b1: 2as0 B:1-72 [127229]
   Other proteins in same PDB: d2as0a2, d2as0b2
   automated match to d2as0a1

Details for d2as0b1

PDB Entry: 2as0, 1.8 Å

PDB Description: Crystal Structure of PH1915 (APC 5817): A Hypothetical RNA Methyltransferase

PDB Compounds: (B:) hypothetical protein PH1915

SCOPe Domain Sequences for d2as0b1:

Sequence; same for both SEQRES and ATOM records:

>d2as0b1 b.122.1.9 (B:1-72) Hypothetical protein PH1915, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
marvvvdaqaaraigkgamivfkkgvvrvegdikpgdivevytrggkflgkgfanpnsni
mvrivtkdkdve

Timeline for d2as0b1:

• d2as0b1 first appeared in SCOP 1.73
  
• d2as0b1 appears in SCOPe 2.07