![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (14 families) ![]() |
![]() | Family b.122.1.9: Hypothetical RNA methyltransferase domain (HRMD) [141716] (3 proteins) N-terminal part of Pfam PF03602, structurally similar to PUA domain family |
![]() | Protein Hypothetical protein PH1915, N-terminal domain [141721] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [141722] (1 PDB entry) Uniprot O59578 1-72 |
![]() | Domain d2as0a1: 2as0 A:1-72 [127227] Other proteins in same PDB: d2as0a2, d2as0b2 |
PDB Entry: 2as0 (more details), 1.8 Å
SCOPe Domain Sequences for d2as0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2as0a1 b.122.1.9 (A:1-72) Hypothetical protein PH1915, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} marvvvdaqaaraigkgamivfkkgvvrvegdikpgdivevytrggkflgkgfanpnsni mvrivtkdkdve
Timeline for d2as0a1: