Lineage for d2arzb1 (2arz B:2-239)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801826Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 801827Superfamily b.45.1: FMN-binding split barrel [50475] (4 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 801828Family b.45.1.1: PNP-oxidase like [50476] (16 proteins)
  6. 801869Protein Hypothetical protein PA4388 [141350] (1 species)
  7. 801870Species Pseudomonas aeruginosa [TaxId:287] [141351] (1 PDB entry)
    Uniprot Q9HW16 2-239
  8. 801872Domain d2arzb1: 2arz B:2-239 [127226]
    automatically matched to 2ARZ A:2-239
    complexed with cl, gol

Details for d2arzb1

PDB Entry: 2arz (more details), 2 Å

PDB Description: Crystal Structure of Protein of Unknown Function from Pseudomonas aeruginosa
PDB Compounds: (B:) hypothetical protein PA4388

SCOP Domain Sequences for d2arzb1:

Sequence, based on SEQRES records: (download)

>d2arzb1 b.45.1.1 (B:2-239) Hypothetical protein PA4388 {Pseudomonas aeruginosa [TaxId: 287]}
sveaaknarelllkeyravlsthskkwpgfpfgsvvpycldaegrplilisriaqhthnl
qadprcsmlvgergaediqavgrltllaearqlaeeevaaaaeryyryfpesadyhrvhd
fdfwvlqpvqwrfiggfgaihwlaaervplanpfageaergmvehmnsdhaaaiahyvel
aglpahaaaqlagidtegfhlrigqglhwlpfpaacgnpgavrqalvqlaraerwptv

Sequence, based on observed residues (ATOM records): (download)

>d2arzb1 b.45.1.1 (B:2-239) Hypothetical protein PA4388 {Pseudomonas aeruginosa [TaxId: 287]}
sveaaknarelllkeyravlsthskkwpgfpfgsvvpycldaegrplilisriaqhthnl
qadprcsmlvgeavgrltllaearqlaeeevaaaaeryyryfpesadyhrvhdfdfwvlq
pvqwrfiggfgaihwlaaervplanpfageaergmvehmnsdhaaaiahyvelaglpaha
aaqlagidtegfhlrigqglhwlpfpaacgnpgavrqalvqlaraerwptv

SCOP Domain Coordinates for d2arzb1:

Click to download the PDB-style file with coordinates for d2arzb1.
(The format of our PDB-style files is described here.)

Timeline for d2arzb1: