Lineage for d2arzb2 (2arz B:1-239)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055233Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2055234Family b.45.1.1: PNP-oxidase like [50476] (17 protein domains)
  6. 2055351Protein automated matches [190383] (6 species)
    not a true protein
  7. 2055366Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [187419] (1 PDB entry)
  8. 2055367Domain d2arzb2: 2arz B:1-239 [127226]
    Other proteins in same PDB: d2arza1, d2arzb3
    automated match to d2arza1
    complexed with cl, gol

Details for d2arzb2

PDB Entry: 2arz (more details), 2 Å

PDB Description: Crystal Structure of Protein of Unknown Function from Pseudomonas aeruginosa
PDB Compounds: (B:) hypothetical protein PA4388

SCOPe Domain Sequences for d2arzb2:

Sequence, based on SEQRES records: (download)

>d2arzb2 b.45.1.1 (B:1-239) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
msveaaknarelllkeyravlsthskkwpgfpfgsvvpycldaegrplilisriaqhthn
lqadprcsmlvgergaediqavgrltllaearqlaeeevaaaaeryyryfpesadyhrvh
dfdfwvlqpvqwrfiggfgaihwlaaervplanpfageaergmvehmnsdhaaaiahyve
laglpahaaaqlagidtegfhlrigqglhwlpfpaacgnpgavrqalvqlaraerwptv

Sequence, based on observed residues (ATOM records): (download)

>d2arzb2 b.45.1.1 (B:1-239) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
msveaaknarelllkeyravlsthskkwpgfpfgsvvpycldaegrplilisriaqhthn
lqadprcsmlvgeavgrltllaearqlaeeevaaaaeryyryfpesadyhrvhdfdfwvl
qpvqwrfiggfgaihwlaaervplanpfageaergmvehmnsdhaaaiahyvelaglpah
aaaqlagidtegfhlrigqglhwlpfpaacgnpgavrqalvqlaraerwptv

SCOPe Domain Coordinates for d2arzb2:

Click to download the PDB-style file with coordinates for d2arzb2.
(The format of our PDB-style files is described here.)

Timeline for d2arzb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2arzb3
View in 3D
Domains from other chains:
(mouse over for more information)
d2arza1