Lineage for d2arza1 (2arz A:2-239)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794134Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2794187Protein Hypothetical protein PA4388 [141350] (1 species)
  7. 2794188Species Pseudomonas aeruginosa [TaxId:287] [141351] (1 PDB entry)
    Uniprot Q9HW16 2-239
  8. 2794189Domain d2arza1: 2arz A:2-239 [127225]
    Other proteins in same PDB: d2arzb2, d2arzb3
    complexed with cl, gol
    has additional subdomain(s) that are not in the common domain

Details for d2arza1

PDB Entry: 2arz (more details), 2 Å

PDB Description: Crystal Structure of Protein of Unknown Function from Pseudomonas aeruginosa
PDB Compounds: (A:) hypothetical protein PA4388

SCOPe Domain Sequences for d2arza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2arza1 b.45.1.1 (A:2-239) Hypothetical protein PA4388 {Pseudomonas aeruginosa [TaxId: 287]}
sveaaknarelllkeyravlsthskkwpgfpfgsvvpycldaegrplilisriaqhthnl
qadprcsmlvgergaediqavgrltllaearqlaeeevaaaaeryyryfpesadyhrvhd
fdfwvlqpvqwrfiggfgaihwlaaervplanpfageaergmvehmnsdhaaaiahyvel
aglpahaaaqlagidtegfhlrigqglhwlpfpaacgnpgavrqalvqlaraerwptv

SCOPe Domain Coordinates for d2arza1:

Click to download the PDB-style file with coordinates for d2arza1.
(The format of our PDB-style files is described here.)

Timeline for d2arza1: