SCOP 1.73: Domain d2aryb1: 2ary B:33-354

Lineage for d2aryb1 (2ary B:33-354)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)

6. Protein Calpain large subunit, catalytic domain (domain II) [54041] (5 species)
   includes the N-terminal 'sequence' domain I

7. Species Human(Homo sapiens), mu type [TaxId:9606] [142851] (2 PDB entries)

8. Domain d2aryb1: 2ary B:33-354 [127224]
   automatically matched to 2ARY A:33-354
   complexed with bme, ca

Details for d2aryb1

PDB Entry: 2ary, 2.4 Å

PDB Description: Catalytic domain of Human Calpain-1

PDB Compounds: (B:) Calpain-1 catalytic subunit

SCOP Domain Sequences for d2aryb1:

Sequence; same for both SEQRES and ATOM records:

>d2aryb1 d.3.1.3 (B:33-354) Calpain large subunit, catalytic domain (domain II) {Human(Homo sapiens), mu type [TaxId: 9606]}
naikylgqdyeqlrvrclqsgtlfrdeafppvpqslgykdlgpnssktygikwkrptell
snpqfivdgatrtdicqgalgdcwllaaiasltlndtllhrvvphgqsfqngyagifhfq
lwqfgewvdvvvddllpikdgklvfvhsaegnefwsallekayakvngsyealsggstse
gfedftggvtewyelrkapsdlyqiilkalergsllgcsidissvldmeaitfkklvkgh
aysvtgakqvnyrgqvvslirmrnpwgevewtgawsdsssewnnvdpyerdqlrvkmedg
efwmsfrdfmreftrleicnlt

Timeline for d2aryb1:

• d2aryb1 is new in SCOP 1.73
  
• d2aryb1 appears in SCOP 1.75
  
• d2aryb1 appears in the current release, SCOPe 2.08, called d2aryb_