Lineage for d2arxb_ (2arx B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2778889Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [186754] (21 PDB entries)
  8. 2778911Domain d2arxb_: 2arx B: [127222]
    automated match to d1n3oa_
    complexed with ca, mn, nag

Details for d2arxb_

PDB Entry: 2arx (more details), 2 Å

PDB Description: pterocarpus angolensis seed lectin in complex with the decasaccharide na2f
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d2arxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2arxb_ b.29.1.1 (B:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

SCOPe Domain Coordinates for d2arxb_:

Click to download the PDB-style file with coordinates for d2arxb_.
(The format of our PDB-style files is described here.)

Timeline for d2arxb_: