SCOP 1.73: Domain d2arxa1: 2arx A:1-240

Lineage for d2arxa1 (2arx A:1-240)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (24 PDB entries)

8. Domain d2arxa1: 2arx A:1-240 [127221]
   automatically matched to d1n3oa_
   complexed with bma, ca, gal, man, mn, nag, ndg

Details for d2arxa1

PDB Entry: 2arx, 2 Å

PDB Description: Pterocarpus angolensis seed lectin in complex with the decasaccharide NA2F

PDB Compounds: (A:) lectin

SCOP Domain Sequences for d2arxa1:

Sequence; same for both SEQRES and ATOM records:

>d2arxa1 b.29.1.1 (A:1-240) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt

Timeline for d2arxa1:

• d2arxa1 is new in SCOP 1.73
  
• d2arxa1 appears in SCOP 1.75
  
• d2arxa1 appears in the current release, SCOPe 2.07, called d2arxa_