SCOP 1.73: Domain d2arwa1: 2arw A:5-103

Lineage for d2arwa1 (2arw A:5-103)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
   Pfam PF00041

6. Protein Interleukin-6 receptor alpha chain, domains 2 and 3 [81977] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81978] (3 PDB entries)

8. Domain d2arwa1: 2arw A:5-103 [127220]
   automatically matched to d1n26a3

Details for d2arwa1

PDB Entry: 2arw

PDB Description: the solution structure of the membrane proximal cytokine receptor domain of the human interleukin-6 receptor

PDB Compounds: (A:) Interleukin-6 receptor alpha chain

SCOP Domain Sequences for d2arwa1:

Sequence; same for both SEQRES and ATOM records:

>d2arwa1 b.1.2.1 (A:5-103) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]}
qpdppanitvtavarnprwlsvtwqdphswnssfyrlrfelryraersktfttwmvkdlq
hhcvihdawsglrhvvqlraqeefgqgewsewspeamgt

Timeline for d2arwa1:

• d2arwa1 is new in SCOP 1.73
  
• d2arwa1 appears in SCOP 1.75
  
• d2arwa1 appears in the current release, SCOPe 2.08, called d2arwa_