SCOPe 2.08: Domain d2arwa_: 2arw A:

Lineage for d2arwa_ (2arw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d2arwa_: 2arw A: [127220]
   automated match to d1uc6a_

Details for d2arwa_

PDB Entry: 2arw

PDB Description: the solution structure of the membrane proximal cytokine receptor domain of the human interleukin-6 receptor

PDB Compounds: (A:) Interleukin-6 receptor alpha chain

SCOPe Domain Sequences for d2arwa_:

Sequence; same for both SEQRES and ATOM records:

>d2arwa_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgilqpdppanitvtavarnprwlsvtwqdphswnssfyrlrfelryraersktfttwmv
kdlqhhcvihdawsglrhvvqlraqeefgqgewsewspeamgt

Timeline for d2arwa_:

• d2arwa_ first appeared in SCOP 1.73, called d2arwa1
  
• d2arwa_ appears in SCOPe 2.07