Class g: Small proteins [56992] (85 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) |
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (7 proteins) |
Protein Activin A (Inhibin beta A) [90170] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [90171] (7 PDB entries) |
Domain d2arva1: 2arv A:1-116 [127218] automatically matched to d1s4yb_ complexed with 1pg, gol, so4 |
PDB Entry: 2arv (more details), 2 Å
SCOP Domain Sequences for d2arva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2arva1 g.17.1.2 (A:1-116) Activin A (Inhibin beta A) {Human (Homo sapiens) [TaxId: 9606]} glecdgkvnicckkqffvsfkdigwndwiiapsgyhanycegecpshiagtsgsslsfhs tvinhyrmrghspfanlksccvptklrpmsmlyyddgqniikkdiqnmiveecgcs
Timeline for d2arva1: