Lineage for d2aroh1 (2aro H:24-102)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637645Protein Histone H4 [47125] (4 species)
  7. 637646Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (28 PDB entries)
  8. 637651Domain d2aroh1: 2aro H:24-102 [127216]
    Other proteins in same PDB: d2aroa1, d2arob1, d2aroc1, d2aroe1, d2arof1, d2arog1
    automatically matched to d1p3ob_
    complexed with cl, po4

Details for d2aroh1

PDB Entry: 2aro (more details), 2.1 Å

PDB Description: Crystal Structure Of The Native Histone Octamer To 2.1 Angstrom Resolution, Crystalised In The Presence Of S-Nitrosoglutathione
PDB Compounds: (H:) histone h4-vi

SCOP Domain Sequences for d2aroh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aroh1 a.22.1.1 (H:24-102) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

SCOP Domain Coordinates for d2aroh1:

Click to download the PDB-style file with coordinates for d2aroh1.
(The format of our PDB-style files is described here.)

Timeline for d2aroh1: