Class a: All alpha proteins [46456] (258 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (4 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (28 PDB entries) |
Domain d2aroh1: 2aro H:24-102 [127216] Other proteins in same PDB: d2aroa1, d2arob1, d2aroc1, d2aroe1, d2arof1, d2arog1 automatically matched to d1p3ob_ complexed with cl, po4 |
PDB Entry: 2aro (more details), 2.1 Å
SCOP Domain Sequences for d2aroh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aroh1 a.22.1.1 (H:24-102) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta mdvvyalkrqgrtlygfgg
Timeline for d2aroh1: