Lineage for d2arof1 (2aro F:33-124)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637443Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
    form octamers composed of two copies of each of the four histones
  6. 637506Protein Histone H2B [47119] (5 species)
  7. 637558Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (6 PDB entries)
  8. 637562Domain d2arof1: 2aro F:33-124 [127214]
    Other proteins in same PDB: d2aroa1, d2aroc1, d2arod1, d2aroe1, d2arog1, d2aroh1
    automatically matched to d1eqzb_
    complexed with cl, po4

Details for d2arof1

PDB Entry: 2aro (more details), 2.1 Å

PDB Description: Crystal Structure Of The Native Histone Octamer To 2.1 Angstrom Resolution, Crystalised In The Presence Of S-Nitrosoglutathione
PDB Compounds: (F:) histone h2b

SCOP Domain Sequences for d2arof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2arof1 a.22.1.1 (F:33-124) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytss

SCOP Domain Coordinates for d2arof1:

Click to download the PDB-style file with coordinates for d2arof1.
(The format of our PDB-style files is described here.)

Timeline for d2arof1: