Lineage for d2aroe1 (2aro E:14-117)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909266Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 909267Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 909268Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 909269Protein Histone H2A [47115] (7 species)
  7. 909323Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (6 PDB entries)
    Uniprot P02263
  8. 909327Domain d2aroe1: 2aro E:14-117 [127213]
    Other proteins in same PDB: d2arob1, d2aroc_, d2arod1, d2arof1, d2arog_, d2aroh1
    automatically matched to d1eqze_
    complexed with cl, po4

Details for d2aroe1

PDB Entry: 2aro (more details), 2.1 Å

PDB Description: Crystal Structure Of The Native Histone Octamer To 2.1 Angstrom Resolution, Crystalised In The Presence Of S-Nitrosoglutathione
PDB Compounds: (E:) histone h2a-IV

SCOPe Domain Sequences for d2aroe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aroe1 a.22.1.1 (E:14-117) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
aksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaardn
kktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllp

SCOPe Domain Coordinates for d2aroe1:

Click to download the PDB-style file with coordinates for d2aroe1.
(The format of our PDB-style files is described here.)

Timeline for d2aroe1: