Lineage for d2arod_ (2aro D:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725671Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1725672Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1725673Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1725987Protein Histone H4 [47125] (7 species)
  7. 1726072Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47126] (6 PDB entries)
    Uniprot P62801
  8. 1726075Domain d2arod_: 2aro D: [127212]
    Other proteins in same PDB: d2aroa_, d2arob_, d2aroc_, d2aroe_, d2arof_, d2arog_
    automated match to d1kx5b_
    complexed with cl, po4

Details for d2arod_

PDB Entry: 2aro (more details), 2.1 Å

PDB Description: Crystal Structure Of The Native Histone Octamer To 2.1 Angstrom Resolution, Crystalised In The Presence Of S-Nitrosoglutathione
PDB Compounds: (D:) histone h4-vi

SCOPe Domain Sequences for d2arod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2arod_ a.22.1.1 (D:) Histone H4 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
tvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d2arod_:

Click to download the PDB-style file with coordinates for d2arod_.
(The format of our PDB-style files is described here.)

Timeline for d2arod_: