| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2A [47115] (6 species) |
| Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47116] (6 PDB entries) Uniprot P02263 |
| Domain d2aroa1: 2aro A:13-118 [127209] Other proteins in same PDB: d2arob1, d2aroc1, d2arod1, d2arof1, d2arog1, d2aroh1 automatically matched to d1eqze_ complexed with cl, po4 |
PDB Entry: 2aro (more details), 2.1 Å
SCOP Domain Sequences for d2aroa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aroa1 a.22.1.1 (A:13-118) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
kaksrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard
nkktriiprhlqlairndeelnkllgkvtiaqggvlpniqavllpk
Timeline for d2aroa1: