Lineage for d2arkf1 (2ark F:1-184)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825904Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 826166Family c.23.5.8: WrbA-like [117474] (2 proteins)
  6. 826167Protein Flavodoxin FldA [142054] (1 species)
  7. 826168Species Aquifex aeolicus [TaxId:63363] [142055] (1 PDB entry)
    Uniprot O67866 1-184
  8. 826174Domain d2arkf1: 2ark F:1-184 [127207]
    automatically matched to 2ARK A:1-184
    complexed with gol, po4

Details for d2arkf1

PDB Entry: 2ark (more details), 2.4 Å

PDB Description: structure of a flavodoxin from aquifex aeolicus
PDB Compounds: (F:) flavodoxin

SCOP Domain Sequences for d2arkf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2arkf1 c.23.5.8 (F:1-184) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]}
mgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgsptn
mglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgflvf
gvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekirkdp
arfv

SCOP Domain Coordinates for d2arkf1:

Click to download the PDB-style file with coordinates for d2arkf1.
(The format of our PDB-style files is described here.)

Timeline for d2arkf1: