Lineage for d2arkd_ (2ark D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838859Family c.23.5.8: WrbA-like [117474] (3 proteins)
  6. 1838860Protein Flavodoxin FldA [142054] (1 species)
  7. 1838861Species Aquifex aeolicus [TaxId:63363] [142055] (1 PDB entry)
    Uniprot O67866 1-184
  8. 1838865Domain d2arkd_: 2ark D: [127205]
    automated match to d2arka1
    complexed with gol, po4

Details for d2arkd_

PDB Entry: 2ark (more details), 2.4 Å

PDB Description: structure of a flavodoxin from aquifex aeolicus
PDB Compounds: (D:) flavodoxin

SCOPe Domain Sequences for d2arkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2arkd_ c.23.5.8 (D:) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]}
snamgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgs
ptnmglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgf
lvfgvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekir
kdparfv

SCOPe Domain Coordinates for d2arkd_:

Click to download the PDB-style file with coordinates for d2arkd_.
(The format of our PDB-style files is described here.)

Timeline for d2arkd_: