SCOPe 2.01: Domain d2arkb_: 2ark B:

Lineage for d2arkb_ (2ark B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.8: WrbA-like [117474] (3 proteins)

6. Protein Flavodoxin FldA [142054] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [142055] (1 PDB entry)
   Uniprot O67866 1-184

8. Domain d2arkb_: 2ark B: [127203]
   automated match to d2arka1
   complexed with gol, po4

Details for d2arkb_

PDB Entry: 2ark, 2.4 Å

PDB Description: structure of a flavodoxin from aquifex aeolicus

PDB Compounds: (B:) flavodoxin

SCOPe Domain Sequences for d2arkb_:

Sequence; same for both SEQRES and ATOM records:

>d2arkb_ c.23.5.8 (B:) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]}
namgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgsp
tnmglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgfl
vfgvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekirk
dparfv

Timeline for d2arkb_:

• d2arkb_ first appeared in SCOP 1.73, called d2arkb1
  
• d2arkb_ was called d2arkb1 in SCOP 1.75
  
• d2arkb_ appears in SCOPe 2.02
  
• d2arkb_ appears in the current release, SCOPe 2.08, called d2arkb2