Lineage for d2arka1 (2ark A:1-184)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2115993Family c.23.5.8: WrbA-like [117474] (3 proteins)
  6. 2115994Protein Flavodoxin FldA [142054] (1 species)
  7. 2115995Species Aquifex aeolicus [TaxId:63363] [142055] (1 PDB entry)
    Uniprot O67866 1-184
  8. 2115996Domain d2arka1: 2ark A:1-184 [127202]
    Other proteins in same PDB: d2arka2, d2arkb3, d2arkc3, d2arkd3, d2arkf3
    complexed with gol, po4

Details for d2arka1

PDB Entry: 2ark (more details), 2.4 Å

PDB Description: structure of a flavodoxin from aquifex aeolicus
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d2arka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2arka1 c.23.5.8 (A:1-184) Flavodoxin FldA {Aquifex aeolicus [TaxId: 63363]}
mgkvlviydtrtgntkkmaelvaegarslegtevrlkhvdeatkedvlwadglavgsptn
mglvswkmkrffddvlgdlwgeidgkiacafsssggwgggnevacmsiltmlmnfgflvf
gvtdyvgkkftlhygavvageprseeekeacrrlgrrlaewvaifvdgrkellekirkdp
arfv

SCOPe Domain Coordinates for d2arka1:

Click to download the PDB-style file with coordinates for d2arka1.
(The format of our PDB-style files is described here.)

Timeline for d2arka1: