Lineage for d2arjr_ (2arj R:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103395Protein CD8 [48734] (3 species)
  7. 1103404Species Mouse (Mus musculus) [TaxId:10090] [48736] (5 PDB entries)
  8. 1103416Domain d2arjr_: 2arj R: [127201]
    Other proteins in same PDB: d2arja1, d2arja2, d2arjb1, d2arjb2, d2arjh1, d2arjh2, d2arjl1, d2arjl2
    automated match to d1bqhh_

Details for d2arjr_

PDB Entry: 2arj (more details), 2.88 Å

PDB Description: CD8alpha-alpha in complex with YTS 105.18 Fab
PDB Compounds: (R:) T-cell surface glycoprotein CD8 alpha chain

SCOPe Domain Sequences for d2arjr_:

Sequence, based on SEQRES records: (download)

>d2arjr_ b.1.1.1 (R:) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvn

Sequence, based on observed residues (ATOM records): (download)

>d2arjr_ b.1.1.1 (R:) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdekklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvn

SCOPe Domain Coordinates for d2arjr_:

Click to download the PDB-style file with coordinates for d2arjr_.
(The format of our PDB-style files is described here.)

Timeline for d2arjr_: