Lineage for d2arjr1 (2arj R:4-122)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652103Protein CD8 [48734] (2 species)
  7. 652108Species Mouse (Mus musculus) [TaxId:10090] [48736] (4 PDB entries)
  8. 652118Domain d2arjr1: 2arj R:4-122 [127201]
    automatically matched to d1bqhh_

Details for d2arjr1

PDB Entry: 2arj (more details), 2.88 Å

PDB Description: CD8alpha-alpha in complex with YTS 105.18 Fab
PDB Compounds: (R:) T-cell surface glycoprotein CD8 alpha chain

SCOP Domain Sequences for d2arjr1:

Sequence, based on SEQRES records: (download)

>d2arjr1 b.1.1.1 (R:4-122) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkv

Sequence, based on observed residues (ATOM records): (download)

>d2arjr1 b.1.1.1 (R:4-122) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdekklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkv

SCOP Domain Coordinates for d2arjr1:

Click to download the PDB-style file with coordinates for d2arjr1.
(The format of our PDB-style files is described here.)

Timeline for d2arjr1: