Lineage for d2arjq1 (2arj Q:4-122)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781680Protein CD8 [48734] (3 species)
  7. 781685Species Mouse (Mus musculus) [TaxId:10090] [48736] (4 PDB entries)
  8. 781694Domain d2arjq1: 2arj Q:4-122 [127200]
    Other proteins in same PDB: d2arja1, d2arja2, d2arjb1, d2arjb2, d2arjh1, d2arjh2, d2arjl1, d2arjl2
    automatically matched to d1bqhh_

Details for d2arjq1

PDB Entry: 2arj (more details), 2.88 Å

PDB Description: CD8alpha-alpha in complex with YTS 105.18 Fab
PDB Compounds: (Q:) T-cell surface glycoprotein CD8 alpha chain

SCOP Domain Sequences for d2arjq1:

Sequence, based on SEQRES records: (download)

>d2arjq1 b.1.1.1 (Q:4-122) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkv

Sequence, based on observed residues (ATOM records): (download)

>d2arjq1 b.1.1.1 (Q:4-122) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdekklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkv

SCOP Domain Coordinates for d2arjq1:

Click to download the PDB-style file with coordinates for d2arjq1.
(The format of our PDB-style files is described here.)

Timeline for d2arjq1: