SCOP 1.73: Domain d2arjq1: 2arj Q:4-122

Lineage for d2arjq1 (2arj Q:4-122)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein CD8 [48734] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [48736] (4 PDB entries)

8. Domain d2arjq1: 2arj Q:4-122 [127200]
   automatically matched to d1bqhh_

Details for d2arjq1

PDB Entry: 2arj, 2.88 Å

PDB Description: CD8alpha-alpha in complex with YTS 105.18 Fab

PDB Compounds: (Q:) T-cell surface glycoprotein CD8 alpha chain

SCOP Domain Sequences for d2arjq1:

Sequence, based on SEQRES records:

>d2arjq1 b.1.1.1 (Q:4-122) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkv

Sequence, based on observed residues (ATOM records):

>d2arjq1 b.1.1.1 (Q:4-122) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdekklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkv

Timeline for d2arjq1:

• d2arjq1 is new in SCOP 1.73
  
• d2arjq1 appears in SCOP 1.75
  
• d2arjq1 appears in the current release, SCOPe 2.08, called d2arjq_