Lineage for d2arhc_ (2arh C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1921278Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1921279Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1921786Family d.108.1.9: Aq_1966-like [143720] (1 protein)
    Pfam PF06557; DUF1122; probable biological unit is homotrimeric; may have evolved different function; putative active site maps to the same location in the common fold
  6. 1921787Protein Hypothetical protein Aq_1966 [143721] (1 species)
  7. 1921788Species Aquifex aeolicus [TaxId:63363] [143722] (1 PDB entry)
    Uniprot O67778 1-196
  8. 1921791Domain d2arhc_: 2arh C: [127199]
    automated match to d2arha1
    complexed with ca, se, so4

Details for d2arhc_

PDB Entry: 2arh (more details), 2.46 Å

PDB Description: crystal structure of a protein of unknown function aq1966 from aquifex aeolicus vf5
PDB Compounds: (C:) hypothetical protein aq_1966

SCOPe Domain Sequences for d2arhc_:

Sequence, based on SEQRES records: (download)

>d2arhc_ d.108.1.9 (C:) Hypothetical protein Aq_1966 {Aquifex aeolicus [TaxId: 63363]}
vkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkpywq
pwvevfgvnpnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppalsr
lgfellklgytyfrdwfipeglmegghkiqaekpkteeakkrhlenlkkefeefigkced
eglikkvkerynf

Sequence, based on observed residues (ATOM records): (download)

>d2arhc_ d.108.1.9 (C:) Hypothetical protein Aq_1966 {Aquifex aeolicus [TaxId: 63363]}
vkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkpywq
pwvevfgvnpnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppalsr
lgfellklgytyfrdwfipeglmegghkiqaekpkteeakkrhlenlkkefeefigegli
kkvkerynf

SCOPe Domain Coordinates for d2arhc_:

Click to download the PDB-style file with coordinates for d2arhc_.
(The format of our PDB-style files is described here.)

Timeline for d2arhc_: