SCOP 1.75: Domain d2arhc1: 2arh C:2-194

Lineage for d2arhc1 (2arh C:2-194)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families)

5. Family d.108.1.9: Aq_1966-like [143720] (1 protein)
   Pfam PF06557; DUF1122; probable biological unit is homotrimeric; may have evolved different function; putative active site maps to the same location in the common fold

6. Protein Hypothetical protein Aq_1966 [143721] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [143722] (1 PDB entry)
   Uniprot O67778 1-196

8. Domain d2arhc1: 2arh C:2-194 [127199]
   automatically matched to 2ARH A:1-196
   complexed with ca, se, so4

Details for d2arhc1

PDB Entry: 2arh, 2.46 Å

PDB Description: crystal structure of a protein of unknown function aq1966 from aquifex aeolicus vf5

PDB Compounds: (C:) hypothetical protein aq_1966

SCOP Domain Sequences for d2arhc1:

Sequence, based on SEQRES records:

>d2arhc1 d.108.1.9 (C:2-194) Hypothetical protein Aq_1966 {Aquifex aeolicus [TaxId: 63363]}
vkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkpywq
pwvevfgvnpnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppalsr
lgfellklgytyfrdwfipeglmegghkiqaekpkteeakkrhlenlkkefeefigkced
eglikkvkerynf

Sequence, based on observed residues (ATOM records):

>d2arhc1 d.108.1.9 (C:2-194) Hypothetical protein Aq_1966 {Aquifex aeolicus [TaxId: 63363]}
vkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkpywq
pwvevfgvnpnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppalsr
lgfellklgytyfrdwfipeglmegghkiqaekpkteeakkrhlenlkkefeefigegli
kkvkerynf

Timeline for d2arhc1:

• d2arhc1 first appeared in SCOP 1.73
  
• d2arhc1 is called d2arhc_ in SCOPe 2.01
  
• d2arhc1 appears in the current release, SCOPe 2.08, called d2arhc_