Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.9: Aq_1966-like [143720] (1 protein) Pfam PF06557; DUF1122; probable biological unit is homotrimeric; may have evolved different function; putative active site maps to the same location in the common fold |
Protein Hypothetical protein Aq_1966 [143721] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [143722] (1 PDB entry) Uniprot O67778 1-196 |
Domain d2arhb_: 2arh B: [127198] automated match to d2arha1 complexed with ca, se, so4 |
PDB Entry: 2arh (more details), 2.46 Å
SCOPe Domain Sequences for d2arhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2arhb_ d.108.1.9 (B:) Hypothetical protein Aq_1966 {Aquifex aeolicus [TaxId: 63363]} mvkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkpyw qpwvevfgvnpnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppals rlgfellklgytyfrdwfipeglmegghkiqaekpkteeakkrhlenlkkefeefigkce deglikkvkerynfleh
Timeline for d2arhb_: