| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
| Family d.108.1.9: Aq_1966-like [143720] (1 protein) Pfam PF06557; DUF1122; probable biological unit is homotrimeric; may have evolved different function; putative active site maps to the same location in the common fold |
| Protein Hypothetical protein Aq_1966 [143721] (1 species) |
| Species Aquifex aeolicus [TaxId:63363] [143722] (1 PDB entry) Uniprot O67778 1-196 |
| Domain d2arha1: 2arh A:1-196 [127197] complexed with ca, se, so4 |
PDB Entry: 2arh (more details), 2.46 Å
SCOPe Domain Sequences for d2arha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2arha1 d.108.1.9 (A:1-196) Hypothetical protein Aq_1966 {Aquifex aeolicus [TaxId: 63363]}
mvkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkpyw
qpwvevfgvnpnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppals
rlgfellklgytyfrdwfipeglmegghkiqaekpkteeakkrhlenlkkefeefigkce
deglikkvkerynfle
Timeline for d2arha1: