Lineage for d2arha1 (2arh A:1-196)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870001Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 870002Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (10 families) (S)
  5. 870434Family d.108.1.9: Aq_1966-like [143720] (1 protein)
    Pfam PF06557; DUF1122; probable biological unit is homotrimeric; may have evolved different function; putative active site maps to the same location in the common fold
  6. 870435Protein Hypothetical protein Aq_1966 [143721] (1 species)
  7. 870436Species Aquifex aeolicus [TaxId:63363] [143722] (1 PDB entry)
    Uniprot O67778 1-196
  8. 870437Domain d2arha1: 2arh A:1-196 [127197]
    complexed with ca, se, so4

Details for d2arha1

PDB Entry: 2arh (more details), 2.46 Å

PDB Description: crystal structure of a protein of unknown function aq1966 from aquifex aeolicus vf5
PDB Compounds: (A:) hypothetical protein aq_1966

SCOP Domain Sequences for d2arha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2arha1 d.108.1.9 (A:1-196) Hypothetical protein Aq_1966 {Aquifex aeolicus [TaxId: 63363]}
mvkyeellktlenginseegeirlvrksqgrfkeefnfdlslgskplltlkvflgrkpyw
qpwvevfgvnpnlrnvffgseaerklyeflsehfgrifveyfedkettyelqkgvppals
rlgfellklgytyfrdwfipeglmegghkiqaekpkteeakkrhlenlkkefeefigkce
deglikkvkerynfle

SCOP Domain Coordinates for d2arha1:

Click to download the PDB-style file with coordinates for d2arha1.
(The format of our PDB-style files is described here.)

Timeline for d2arha1: