![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (4 proteins) |
![]() | Protein Legume lectin [49904] (23 species) |
![]() | Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (24 PDB entries) |
![]() | Domain d2areb1: 2are B:1-240 [127196] automatically matched to d1n3oa_ complexed with ca, man, mn |
PDB Entry: 2are (more details), 1.8 Å
SCOP Domain Sequences for d2areb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2areb1 b.29.1.1 (B:1-240) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
Timeline for d2areb1: