Lineage for d2ar6a_ (2ar6 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. Protein automated matches [190035] (28 species)
    not a true protein
  7. Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [186754] (21 PDB entries)
  8. Domain d2ar6a_: 2ar6 A: [127191]
    automated match to d1n3oa_
    complexed with ca, mn

Details for d2ar6a_

PDB Entry: 2ar6 (more details), 1.8 Å

PDB Description: pterocarpus angolensis lectin (pal) in complex with the pentasaccharide m592
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d2ar6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ar6a_ b.29.1.1 (A:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt

SCOPe Domain Coordinates for d2ar6a_ are not available.

Timeline for d2ar6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ar6b_