Lineage for d2ar0a1 (2ar0 A:6-529)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130341Family c.66.1.45: N-6 DNA Methylase-like [142606] (3 protein domains)
    Pfam PF02384; contains C-terminal extension to the canonical fold and extra N-terminal all-alpha domain similar to the insert domain of the DAM family (88788)
  6. 2130345Protein M.EcoKI [142609] (1 species)
    contains extra C-terminal structured region
  7. 2130346Species Escherichia coli [TaxId:562] [142610] (1 PDB entry)
    Uniprot P08957 4-527
  8. 2130347Domain d2ar0a1: 2ar0 A:6-529 [127185]
    complexed with unx

Details for d2ar0a1

PDB Entry: 2ar0 (more details), 2.8 Å

PDB Description: Crystal structure of Type I restriction enzyme EcoKI M protein (EC 2.1.1.72) (M.EcoKI)
PDB Compounds: (A:) Type I restriction enzyme EcoKI M protein

SCOPe Domain Sequences for d2ar0a1:

Sequence, based on SEQRES records: (download)

>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]}
ndlvaklwklcdnlrdggvsyqnyvnelasllflkmcketgqeaeylpegyrwddlksri
gqeqlqfyrkmlvhlgeddkklvqavfhnvsttitepkqitalvsnmdsldwyngahgks
rddfgdmyegllqknanetksgagqyftprpliktiihllkpqprevvqdpaagtagfli
eadryvksqtndlddldgdtqdfqihrafiglelvpgtrrlalmncllhdiegnldhgga
irlgntlgsdgenlpkahivatnppfgsaagtnitrtfvhptsnkqlcfmqhiietlhpg
graavvvpdnvlfeggkgtdirrdlmdkchlhtilrlptgifyaqgvktnvlfftkgtva
npnqdknctddvwvydlrtnmpsfgkrtpftdehlqpfervygedphglsprtegewsfn
aeetevadseenkntdqhlatsrwrkfsrewirtaksdsldiswlkdkdsidadslpepd
vlaaeamgelvqalseldalmrelgasdeadlqrqlleeafggv

Sequence, based on observed residues (ATOM records): (download)

>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]}
ndlvaklwklcdnlrdggvsyqnyvnelasllflkmcketgqeaeylpegyrwddlksri
gqeqlqfyrkmlvhlgeddkklvqavfhnvsttitepkqitalvsnmdsldwqyftprpl
iktiihllkpqprevvqdpaagtagflieadryvksqtndlddldgdtqdfqihrafigl
elvpgtrrlalmncllhdiegnldhggairlgntlgsdgenlpkahivatnppfgsaagt
nitrtfvhptsnkqlcfmqhiietlhpggraavvvpdnvlfeggkgtdirrdlmdkchlh
tilrlptgifyaqgvktnvlfftkgtvanpnqdknctddvwvydlrtnmpsfgkrtpftd
ehlqpfervygedphglsprtegewsfnaeetevadseenkntdqhlatsrwrkfsrewi
rtaksdsldiswlkdkdpepdvlaaeamgelvqalseldalmrelgasdeadlqrqllee
afggv

SCOPe Domain Coordinates for d2ar0a1:

Click to download the PDB-style file with coordinates for d2ar0a1.
(The format of our PDB-style files is described here.)

Timeline for d2ar0a1: