Lineage for d2aqwa1 (2aqw A:2-322)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814383Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 814448Family c.1.2.3: Decarboxylase [51375] (3 proteins)
  6. 814562Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species)
  7. 814586Species Plasmodium yoelii [TaxId:5861] [141753] (1 PDB entry)
    Uniprot Q7RPE4 2-322
  8. 814587Domain d2aqwa1: 2aqw A:2-322 [127184]
    complexed with iod, so4

Details for d2aqwa1

PDB Entry: 2aqw (more details), 2 Å

PDB Description: structure of putative orotidine-monophosphate-decarboxylase from plasmodium yoelii (py01515)
PDB Compounds: (A:) putative orotidine-monophosphate-decarboxylase

SCOP Domain Sequences for d2aqwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aqwa1 c.1.2.3 (A:2-322) Protozoan orotidine monophosphate decarboxylase {Plasmodium yoelii [TaxId: 5861]}
hfktklknrrsevntclcigldpdeddiknfmkneeqngykniknnmnsnnngieniiki
gkeilltdgeniqnlseedkffyffnhfcfyiinntkeyalvykmnfafyipygsvgina
lknvfdylnsmniptmldmkindigntvknyrkfifeylksdsctinvymgtnmlkdicf
dyeknkyysayvlikttnkdsfifqnelsindkqayivmadetqkmatelkieqnnefig
fvvgsnafeemkiirnkfpdsyilspgigaqngdlyktlkngynkdyekllinvgraitk
spdpkkssesyynqiiqifkd

SCOP Domain Coordinates for d2aqwa1:

Click to download the PDB-style file with coordinates for d2aqwa1.
(The format of our PDB-style files is described here.)

Timeline for d2aqwa1: