Lineage for d2aqfa1 (2aqf A:2-90)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1257872Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1258623Family a.4.1.18: SWIRM domain [140222] (3 proteins)
    Pfam PF04433; contains extra N-terminal helix
  6. 1258638Protein Transcriptional adaptor 2-like, TADA2L [140225] (1 species)
  7. 1258639Species Mouse (Mus musculus) [TaxId:10090] [140226] (3 PDB entries)
    Uniprot Q8CHV6 343-443! Uniprot Q8CHV6 355-443
  8. 1258640Domain d2aqfa1: 2aqf A:2-90 [127180]
    automatically matched to 2AQE A:2-90

Details for d2aqfa1

PDB Entry: 2aqf (more details)

PDB Description: structural and functional analysis of ada2 alpha swirm domain
PDB Compounds: (A:) Transcriptional adaptor 2, Ada2 alpha

SCOPe Domain Sequences for d2aqfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aqfa1 a.4.1.18 (A:2-90) Transcriptional adaptor 2-like, TADA2L {Mouse (Mus musculus) [TaxId: 10090]}
snsgrrsapplnltglpgteklnekekelcqvvrlvpgayleyksallnechkqgglrla
qaralikidvnktrkiydfliregyitka

SCOPe Domain Coordinates for d2aqfa1:

Click to download the PDB-style file with coordinates for d2aqfa1.
(The format of our PDB-style files is described here.)

Timeline for d2aqfa1: