Lineage for d2aqfa2 (2aqf A:2-90)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692654Family a.4.1.18: SWIRM domain [140222] (4 proteins)
    Pfam PF04433; contains extra N-terminal helix
  6. 2692688Protein Transcriptional adaptor 2-like, TADA2L [140225] (1 species)
  7. 2692689Species Mouse (Mus musculus) [TaxId:10090] [140226] (3 PDB entries)
    Uniprot Q8CHV6 343-443! Uniprot Q8CHV6 355-443
  8. 2692690Domain d2aqfa2: 2aqf A:2-90 [127180]
    Other proteins in same PDB: d2aqfa3
    automated match to d2aqfa1

Details for d2aqfa2

PDB Entry: 2aqf (more details)

PDB Description: structural and functional analysis of ada2 alpha swirm domain
PDB Compounds: (A:) Transcriptional adaptor 2, Ada2 alpha

SCOPe Domain Sequences for d2aqfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aqfa2 a.4.1.18 (A:2-90) Transcriptional adaptor 2-like, TADA2L {Mouse (Mus musculus) [TaxId: 10090]}
snsgrrsapplnltglpgteklnekekelcqvvrlvpgayleyksallnechkqgglrla
qaralikidvnktrkiydfliregyitka

SCOPe Domain Coordinates for d2aqfa2:

Click to download the PDB-style file with coordinates for d2aqfa2.
(The format of our PDB-style files is described here.)

Timeline for d2aqfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aqfa3