SCOPe 2.08: Domain d2aqea1: 2aqe A:2-90

Lineage for d2aqea1 (2aqe A:2-90)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.18: SWIRM domain [140222] (4 proteins)
   Pfam PF04433; contains extra N-terminal helix

6. Protein Transcriptional adaptor 2-like, TADA2L [140225] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140226] (3 PDB entries)
   Uniprot Q8CHV6 343-443! Uniprot Q8CHV6 355-443

8. Domain d2aqea1: 2aqe A:2-90 [127179]
   Other proteins in same PDB: d2aqea2

Details for d2aqea1

PDB Entry: 2aqe

PDB Description: structural and functional analysis of ada2 alpha swirm domain

PDB Compounds: (A:) Transcriptional adaptor 2, Ada2 alpha

SCOPe Domain Sequences for d2aqea1:

Sequence; same for both SEQRES and ATOM records:

>d2aqea1 a.4.1.18 (A:2-90) Transcriptional adaptor 2-like, TADA2L {Mouse (Mus musculus) [TaxId: 10090]}
snsgrrsapplnltglpgteklnekekelcqvvrlvpgayleyksallnechkqgglrla
qaralikidvnktrkiydfliregyitka

Timeline for d2aqea1:

• d2aqea1 first appeared in SCOP 1.73
  
• d2aqea1 appears in SCOPe 2.07